PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s948721g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NAC
Protein Properties Length: 312aa    MW: 35059.9 Da    PI: 8.4301
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s948721g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.91.6e-5651301128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeel+++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+
  PDK_30s948721g002   5 LPPGFRFHPTDEELITYYLTRKVSDFGFAA-KAIADVDLNKCEPWDLPAKASMGEKEWYFFSLRDRKYPTGMRTNRATDAGYWKTTGKDKEI 95 
                        79*************************999.88***************999999************************************** PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++  g lvg+kktLvfykgrapkgekt+Wvmheyrl
  PDK_30s948721g002  96 FH-CGVLVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 130
                        **.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-643151IPR003441NAC domain
PROSITE profilePS5100560.1255151IPR003441NAC domain
PfamPF023656.0E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLTRKVSDF GFAAKAIADV DLNKCEPWDL PAKASMGEKE  60
WYFFSLRDRK YPTGMRTNRA TDAGYWKTTG KDKEIFHCGV LVGMKKTLVF YKGRAPKGEK  120
TNWVMHEYRL QTKFPYRTTK EEWVVCRVFK KSSNGKKTQP NTPPLPPLLE SPCNTTSLSE  180
LGELDVSILS NLVTNGPDGM QVNDSINKEV DMNMYMNWVL AREATSQPSL PWTSSLLGMG  240
YLPSPAILKA LPFNGCQPQE ATNLTSLSSF AAQANPLLGS ESKSSFPSSS AKAIEVPQQQ  300
QPFDQGPIWR GY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-59415716171NAC domain-containing protein 19
4dul_A6e-59415716171NAC domain-containing protein 19
1ut7_B6e-59415716171NO APICAL MERISTEM PROTEIN
1ut7_A6e-59415716171NO APICAL MERISTEM PROTEIN
1ut4_B6e-59415716171NO APICAL MERISTEM PROTEIN
1ut4_A6e-59415716171NO APICAL MERISTEM PROTEIN
3swp_D8e-59415719174NAC domain-containing protein 19
3swp_C8e-59415719174NAC domain-containing protein 19
3swp_B8e-59415719174NAC domain-containing protein 19
3swp_A8e-59415719174NAC domain-containing protein 19
3swm_D8e-59415719174NAC domain-containing protein 19
3swm_C8e-59415719174NAC domain-containing protein 19
3swm_B8e-59415719174NAC domain-containing protein 19
3swm_A8e-59415719174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797830.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLR34e-83NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM0TRJ51e-136M0TRJ5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P18420_0011e-135(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-102NAC domain containing protein 58